Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 8.9e-56
Percent Similarity (|+|): 65.2    Percent Identity (|): 40.6



     251 SPVQSGFNNGTISNYMYFERRPDLLTKGTQDKAAAVKL.KIENFYQSSVK 299
                                        ..|.||| |||.|  ... 
       1 ...............................MSAEVRLRRLQQLVLDPGF 19

     300 YAIER.NERRVELETELTSHNWSEERKSRQLSSLGKKESQFLRLRRTRLS 348
         .|||.  |  |||. ||.. ||.|||   ||  |.. |. .|||| .|| 
      20 LGLEPLLDLLLGVHQELGASELAQDKYVADF..LQWAEPIVVRLKEVRLQ 67

     349 LEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVK 398
          |||..|||||||||||| ||..||||.|||||.| |.||.|||||. .|
      68 RDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFR 117

     399 AERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW.QLF 447
         .|||||..||..||. |.|.|||..||||||||..|||||||| || | |
     118 EERDVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERI 167

     448 TEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLS 497
         ..||.||||||.|||||.|||||||||||||||||||  |||||.||| |
     168 PAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSC 217

     498 TGFHKTHDSNYYKKLLQQDEATNGISKPGTYNANTTDTANKRQTMVVDSI 547
           ||                            ||.|              
     218 LKLR............................ADGT.............. 225

     548 SLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQG.......YGQ 590
                         |.|||   |||||||.||||   |       ||.
     226 ...............VRSLVA...VGTPDYLSPEILQAVGGGPGTGSYGP 257

     591 ECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP.DDIHIS 639
         |||||.||.| || |.| .|||.|...||| |||||.| | ||  |  |.
     258 ECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVP 307

     640 YEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIP 689
          || |||.|||..|| |||| |||||||.|||| |||||.|||  |||.|
     308 EEARDFIQRLLCPPETRLGR.GGAGDFRTHPFFFGLDWDGLRDSVPPFTP 356

     690 KLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPF 739
         .|.| |||  |.  |           || ...| |..  |||||  .|||
     357 DFEGATDTCNFDLVE...........DGLTAMETLSDIREGAPLGVHLPF 395

     740 IGYTYSRFDYLTRKNAL................................. 756
         |||.|| |..  |...|                                 
     396 VGYSYSCMAL..RDSEVPGPTPMEVEAEQLLEPHVQAPSLEPSVSPQDET 443