Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 1.4e-243
Percent Similarity (|+|): 95.0    Percent Identity (|): 89.1



       1 MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK 50
         ||.|||||||||||||||||||||||||||||||||||||||||||||||
       1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 50

      51 DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 100
         ||||||||||||||||||||||||||||||||||||||||||||||||||
      51 DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 100

     101 HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG 150
         |||||||||||||.||||||||||||||.|||||.||||||||.||||||
     101 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG 150

     151 IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF 200
         |||||||||||.||||.||.|||||||||||||||||||||||.||||||
     151 IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF 200

     201 STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI 250
         .||||||||||||||||||||||||||.||| ||||||||||||||||||
     201 TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI 250

     251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS 300
         ||||||.||||||||.|||||.||.|||||||||||||||||||||.|||
     251 GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS 300

     301 GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT 350
         |||||||||||||||||||||||.|||||||||||||||||||||||||.
     301 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 350

     351 TFQQMWISKQEYDESGPSIVHHKCF. 375
         ||||||||||||||||||||||||| 
     351 TFQQMWISKQEYDESGPSIVHRKCF* 376