Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 1.0e-13
Percent Similarity (|+|): 56.0    Percent Identity (|): 36.1



       1 ................................................MA 2
                                                         .|
      51 EAWVIGSVVARAEGSPRVKVKNLIESMQINGSVLKNGSLTNHFSFEKKKA 100

       3 RIVVLISGSGSNLQALIDAQKQGQLGEDAHIVSVISSSKKAYGLTRAADN 52
         ||.|||||.|||||||||. ||.  ...|||  |||..  . ||.||. .
     101 RVAVLISGTGSNLQALIDSTREP..NSSAQIDIVISNKAAVAGLDKAERA 148

      53 NIPTKVCSLYPYTKGIAKEDKAARAKARSQFENDLAKLVLEEKPDVIICA 102
         .|||||..   |             |.| |||..|. || | . |||. |
     149 GIPTRVINHKLY.............KNRVEFDSAIDLVLEEFSIDIVCLA 185

     103 GWLLILGSTFLSQLQSVPILNLHPALPGCFDGTTHAIEMAWRKCQDENKP 152
         ||| ||||.|| .|.| .||||||.| .||.| .|| | ||     |. .
     186 GFMRILSGPFVQKWNG.KMLNIHPSLLPSFKG.SNAHEQAL.....ETGV 228

     153 LTAGCMVHYVIEEVDKGEPLVVKKLEIIPGEETLEQYEQRVHDAEH.... 198
          ..|| |||| |||| || || . |.| .| |||. ..|||. |||    
     229 TVTGCTVHFVAEDVDAGQIILQEAVPVKRG.DTVATLSERVKLAEHKIFP 277

     199 ..IAIVEATYKVLQQLHK........ 214
           |.||...   |.|  |        
     278 AALQLVASGTVQLGENGKICWVKEE* 303