Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 5.0e-130
Percent Similarity (|+|): 77.9    Percent Identity (|): 60.3


       1 MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEG 50
             |.||.|||||||||||||||| .  .||   |||||||||||||||
       1 ....MEDYTKIEKIGEGTYGVVYKGRHKTTGQ...VVAMKKIRLESEEEG 43

      51 VPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYME 100 
         ||||||||||||||||..|||.| |||  |. |||||||||.||||||||
      44 VPSTAIREISLLKELRHPNIVSLQDVLMQDS.RLYLIFEFLSMDLKKYLD 92

     101 GIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNL 150
         |||.|| ||..|||.|| || .||.||||||||||||||||||||..|.|
      93 SIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTI 142

     151 KLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGC 200
         ||||||||||||||||.|||||||||||.||||||| .|||.||.||||.
     143 KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT 192

     201 IFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFP 250
         |||||..||||| |||||||||||||.||||||.|||||  |.||| .||
     193 IFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFP 242

     251 QWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES.. 298
         .||. .|.  |..||..|||||.||| ||| .|||||.|  ||||.|   
     243 KWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDN 292