Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 5.6e-48
Percent Similarity (|+|): 61.4    Percent Identity (|): 44.0



       1 .MMGRGKLILIEGLDRTGKTTQCNILYKKL..QPNCKLLKFPERSTRIGG 47
             || |||||||||.||.|||. | . |  .| ..||||||||| || 
       1 MAARRGALIVLEGVDRAGKSTQSRKLVEALSRGPPPELLRFPERSTEIGK 50
                  .         .         .         .         .
      48 LINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVY 97
         ||..|| ..| ||.||.||||||||||| |. ||..| || .||||||.|
      51 LLSSYLQKKS.DVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAF 99
                  .         .         .         .         .
      98 SGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSGFG 147
         |||||.|||  |.|.|||| |||||| ||||.|||  | |.|.|.|||||
     100 SGVAFTGAK..ENFSLDWCKQPDVGLPKPDLVLFLQLQ.LADAAKRGAFG 146
                  .         .         .         .         .
     148 DERYETVKFQEKVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVEALIW 197
         .||||.. ||||. ..| .||    |... . .||| ..| ||.|.. ||
     147 HERYENGAFQERALRCFHQLM....KDTTLNWKMVD.ASKRLEAVHEELR 191
                  .         .
     198 QIVEPVLSTHIDHDKFSFF. 216
          | |..|.| .|..  .|| 
     192 VLSEDAIRTATEKPLGELWK 211