Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 1.3e-55
Percent Similarity (|+|): 76.9    Percent Identity (|): 59.9


       1 MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVN 50
         |...|||||||||||||.|||||.||.|...|||||||||| .|.||||.
       1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ 50

      51 DLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGL 100
         |||||||.|||  |||.|||.||.|.||..|||||| ||||||||||||.
      51 DMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGY 100

     101 ISAAELKHVLTSIGEKLTDAEVDDMLREVS.DGSGEINIQQFAALLSK.. 147
         |||||||||||.|||||||.||||||||.. ||.||||.|||..||.   
     101 ISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK* 150