Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 3.4e-95
Percent Similarity (|+|): 58.3    Percent Identity (|): 33.2


       1 MPTTYVPINQPIGDGEDVIDTNRFTNIPETQNFDQFVTIDKIAEENRPLS 50
                         |.||    . |||...|||| |||.| |..|  .
       1 ...............MDFLE....EPIPGVGTYDDFNTIDWVREKSR..D 29

      51 VDSDREFLNSKYRHYREVI...WDRAKTFITLSSTAIVIGCIAGFLQVFT 97
          |..||| |..    |.||   .|  ..|| |  .||| ||||||||| .
      30 RDRHREITNKSKESTWALIHSVSDAFSGWLLMLLIGLLSGSLAGLIDISA 79

      98 ETLVNWKTGHCQRNWLLNKSFCC....NGVVNEVTSTSNLLLKRQEFECE 143
         . |.|||.| |  .||||.. ||    |...|| ....||  ..| | |.
      80 HWMTDLKEGICTGGFWFNHEHCCWNSEHVTFEERDKCPEWNSWSQLIIST 129

     144 AQGLWIAWKGHVSPFIIFMLLSVLFALISTLLVKYVAPMATGSGISEIKV 193
         .|| |    |.|  |||||||.||||||.. ||| .|| |.||||.|||.
     130 DEGAF....AYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGIPEIKT 175

     194 WVSGFEYNKEFLGFLTLVIKSVALPLAISSGLSVGKEGPSVHYATCCGYL 243
          |||| . ||||| ||||||.|.|.|||||||||||||| || |.||| |
     176 ILSGFII.RGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNI 224

     244 LTKWLLRDTLTYSSQYEYITAASGAGVAVAFGAPIGGVLFGLEEIASANR 293
         |.. | |   . ... | |.||.||||.|||||||||||||||||.   .
     225 LCHCFNKYRKNEAKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFP 274

     294 FNSSTLWKSYYVALVAITTLKYIDPFRNGRVILFNVTYDRDWKVQEIPIF 343
         |.  |||||||.||||  ||| |||| ||||||| |.|. .|.| ||. |
     275 LK..TLWRSFFAALVAAFTLRSINPFGNSRLVLFYVEFHTPWHLFELVPF 322

     344 IALGIFGGLYGKYISKWNINFIHFRKMY.LSSWPVQEVLFLATLTALISY 392
         | ||||||||| .| | ||.|.| ||   ||.||| |||.|..|||||.|
     323 ILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEVLVVTAITAILAF 372

     393 FNEFLKLDMTESMGILFHEC..VKNDNTSTFSHRL.....CQLDENTHAF 435
          ||| ||. .| || |||||  |.... |.|.|||     .||.|.. |.
     373 PNEYTRMSTSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPAGV 422

     436 EFLKIFTSLCFATVIRALLVVVSYGARVPAGIFVPSMAVGATFGRAVSLL 485
         |... |  |.|. ||| ||.|..|| |||.|||||||||||. || ||| 
     423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVG 472

     486 VERFI..............SGPSVITPGAYAFLGAAATLSGITNLTLTVV 521
         ||.|                ||..|||| ||||||||.|||||.|||.||
     473 MEQLAYYHQEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLV 522

     522 VIMFELTGAFMYIIPLMIVVAITRIILSTSGISGGIADQMIMVNGFPYLE 571
         |||||||||| |||||| ..|||.  |...  .||| |. |.||||||||
     523 VIMFELTGGLEYIVPLM.AAAMTSKWVADALGREGIYDAHIRLNGYPFLE 571

     572 DEQDEEEEETLEKYTAEQLMSSKLITI..NETIYLSELESLLYDSASEYS 619
          ..|| ...||.. . .. ....||||  .|.| |.|||.||  |...||
     572 .AKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETII..SETTYS 618

     620 VHGFPITKDEDKFEKEKRCIGYVLKRHLASKIM.MQSVNSTKAQTTLVYF 668
         . ...|.||.|||      |||||||.|  .|   .. ... . |.||||
     619 GFPVVVSRESQRL......VGFVLRRDLIISIENARKKQDGVVSTSIIYF 662

     669 NKSNEEL.GHRENCIGFKDIMNESPISVKKAVPVTLLFRMFKELGCKTII 717
         .. ...| .. . .| |||||| |||.|.. .||.||. |||.|| | .|
     663 TEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCL 712

     718 VEESGILKGLVTAKDILR.FKRIKYREVHGAKFTYNEALDRRCWSVIHFI 766
         |...| | |||| ||||| | .|  .|..|  |.                
     713 VTHNGRLLGIITKKDVLKHIAQMANQDPDSILFN*............... 747