Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 1.0e-28
Percent Similarity (|+|): 45.3    Percent Identity (|): 21.1


       1 MSQPTKNKKKEHGTDSKSSRMTRTLVNHIL..FERILPILPVESNLSTYS 48
                         ...|.. .||. ||  ||  ||| ..| |  |  
       1 ................MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKV 34

      49 EVEEYSSFISCRSVLINVTVSRDANAMVEGTLELIESLLQGHEIISDKGS 98
         ..|.       |..|||  |||   .|| |.|. | . |..  |||| |.
      35 STEHN......KECLIN..ISKYKFSLVISGLTTILKNVNNMRIFGEAAE 76

      99 SDVIESILIILRLLSDALEYNWQNQESLHYNDISTHVEHDQEQKYRPKLN 148
         .||. | ||||  |...|.   | .|.||.          || .. ..| 
      77 KNLYLSQLIILDTLEKCLAG..QPKDTMRL..........DETMLVKQLL 114

     149 SILPDYSSTHSNGNKHFFHQSKPQALIPELASKLLESCAKLKFNTRTLQI 198
         . |..|  | .|||.|       .| |.| || || |             
     115 PEICHFLHTCREGNQH.......AAELRNSASGVLFS............. 144

     199 LQNMISHVHGNILTTLSSSILPRHKSYLTRHNHPSHCKMIDSTLGHILRF 248
                | .| |..| |.| .|               | | ||      
     145 .......LSCNNFNAVFSRISTR...............LQELTV...... 166

     249 VAASNPSEYFEFIRKSVQVPVTQTHTHSHSHSHSLPSSVYNSIVPHFDLF 298
                                             ||  |  |..||||
     167 ....................................CSEDNVDVHDIELL 180

     299 SFIYLSKHNFKKYLELIKNLSVTLRKTIYHCLLLHYSAKAIMFWIMARPA 348
          || |.  .|||.|.  ..|...  |.| |  |||  .|||  || . |.
     181 QYINVDCAKLKRLLK.ETAFKFKALKKVAQLAVINSLEKAFWNWVENYPD 229

     349 EYYELFNLLKDNNNEHSKSLNTLNHTLFEEIH.....STFNVNSMITTNQ 393
         || .||.| ..| .| ...| .| ..| |...     ..|.|  || . |
     230 EFTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPE 279

     394 NAHQGSSSPSSSSPSSPPSSSSSDNNNQNIIAKSLSRQLSHHQSYIQQQS 443
           || |...            ..|| |..|| .||.|.|. |.|      
     280 IIQDISKDV...........VDENNMNKKLFLDSLRKALAGHGG...... 312

     444 ERKLHSSWTTNSQSSTSLSSSTSNSTTTDFSTHTQPGEYDPSLPDTPTMS 493
              |.  |||.. .||. |.. || .||..|.    . .||  ...|.
     313 .....SRQLTESAAIACVKLCKA.STYINWEDNSVIFLLVQSM..VVDLK 354

     494 NITISASSLLSQTPTPTTQLQQRLNSAAAAAAAAASPSNSTPTGYTAEQQ 543
         || |.||. ||... |.   |  |  .. ...   || |. .  .. .|.
     355 NLLFNPSKPFSRGSQPA...DVDLMIDCLVSCFRISPHNNQHFKICLAQN 401

     544 SRASYDAHKTGHTGKDYDEHFLSVTRLDNVLELYTHFDDTEVLPHTSVLK 593
         |...|              ||| |..|..||.             .|.|.
     402 SPSTF..............HYVLVNSLHRIIT.............NSALD 424

     594 FLTTLTMF...DIDLFNELNATSFKYIPDCTMHRP.........KERTSS 631
         ||..|. .   .||| | |..|  | |.||. |.|         |||..|
     425 WWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTS 474

     632 FNNTAHETGSEKTSGIKHITQGLKKLTSLPSSTKKTVKFVKMLLRNLNGN 681
         |. ....|| | |.|.|.|  || ||.  ..         |||| | . .
     475 LKFKEKPTDLE.TRSYKYLLLSMVKLIHADP.........KLLLCNPRKQ 514

     682 QAVSDVALLDTMRALLSFFTMTSAVFLVDRNLPSVLFAKRLIPIMGTNLS 731
         .| .|..  | | ||| |.. .  . |.| .|..||. ..| .|   | .
     515 GPETQGSTAELITGLVQLVPQSHMPEIAQEAMEALLVLHQLDSIDLWNPD 564

     732 VGQDWNSKINNSLMVCLKKNSTTFVQLQLIFFSSAIQFDHELLLARLSID 781
         .. |  ..|.. ||.|| |. |.    |||  .. |.| |||||.|    
     565 APVETFWEISSQMLFYICKKLTSH...QMLSSTEILKWLREILICR.... 607

     782 TMANNLNMQKLCLYTEGFRIFFDIPSKKELRKAIAVKISKFFKTLFSIIA 831
                                  .|  ||.  | | |  |  |||| .
     608 .........................NKFLLKNKQADRSSCHFLLFYGVGC 632

     832 DILLQEFPYFDEQITDIVASILDGTIINEYGTKKHFKGSSPSLCSTTRSR 881
         ||                                              ..
     633 DI..............................................PS 636

     882 SGSTSQSSMTPVSPLGLDTDICPMNTLSLVGSSTSRNSDNVNSLNSSPKN 931
         ||.||| ||.              |.  | ..|.| ..|..||  .|| .
     637 SGNTSQMSMD..............HEELLRTPGASLRKGKGNSSMDSAAG 672

     932 LSSDPYLSHLVAPRARHALGGPSSIIRNKIPTTLTSPPGTEKSSPVQRPQ 981
          ||.| ||| ...|   ||              | . ||||         
     673 CSGTPPICRQAQTKLEVAL............YMFLWNPDTE......... 701

     982 TESISATPMAITNSTPLSSAAFGIRSPLQKIRTRRYSDESLGKFMKSTNN 1031
              |. |||.   .||..| ||||.||.|        || .||.. |.
     702 .....AVLVAMSCFRHLCEEA.DIRCGVDEV........SVHNLLPNYNT 737

    1032 YIQEHLIPKDLNEATLQDARRIMINIFSIFKRPNSYFIIPHNINSNLQWV 1081
         |||   |.. |..|  . .||||                           
     738 FMEFASVSNMMSTGRAALQKRVM........................... 760

    1082 SQDFRNIMKPIFVAIVSPDVDLQNTAQSFMDTLLSNVITYGESDENISIE 1131
              .|||.|  |..| . .|||| ..| |.                  
     761 .....ALLRRIEHPTAGNTEAWEDTHAKWEQA.................. 787

    1132 GYHLLCSYTVTLFAMGLFDLKINNEKRQILLDITVKFMKVRSHLAGIAEA 1181
                   | | |.. . |||||. .  |. ||              .
     788 ..........TKLILNYPKAKMEDGQAAESLHKTI..............V 813

    1182 SHHMEYISDSEKLTFPLIMGTVGRALFVSLYSSQQKIEKTLKIAYTEYLS 1231
         .|||..|||||.|.|. . |  ||                  |. |||||
     814 KRRMSHVSGGGSIDLSDTDSLQEW..................INMTGFLC 845

    1232 AINFHERNIDDADKTWVHNIEFVEAMCHDNYTTSGSIAFQRRTRNNILRF 1281
         ||                                |||.||.|....|  |
     846 AL................................GGVCLQQRSNSGLATY 863

    1282 ATIPNAILLDSMRMIYKKWHTYTHSKSLEKQERNDFRNFAGILASLSGIL 1331
         ..  .||   . .||                         |||.| |.  
     864 SPPMGPVSERKGSMI.........................SVMSSEGNAD 888

    1332 FINKKILQEMYPYLLDTVSELKKNIDSFISKQCQWLNYPDLLTRENSRDI 1381
            .|||| |...|| . ..|                  || .|.| |||
     889 TPVSKFMDRLLSLMVCNHEKV..................GLQIRTNVKDL 920

    1382 LSVELHPLSFNLLFNNLRLKLKELACSDLSIPENESSYVLLEQIIKMLRT 1431
         ||||| |  | ||||.|| .|..|  ||  |  .|..  ||||.| |||.
     921 VGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKN 970

    1432 ILGRDDDNYVMMLFSTEIVDLIDLLTDEIKKIPAYCPKYLKAIIQMTKMF 1481
         |||...|.    |  ..| .||  |.  || |.. ..  |.  ..|..|.
     971 LLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHA.IQIKTKLCQLV 1019

    1482 SALQHSEVNLGVKNHFHVKNKWLRQITDWFQVSIAREYDFENLSKPLKEM 1531
         ..|  .  |||. ..|..||| |  ||||. .. ... |        .||
    1020 EVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAAD........DDV 1061

    1532 DLVKRDMDILYIDTAIEASTAIAYLTRHTFLEIPPAASDPELSRSRSVIF 1581
         . |.||||   ||..|.  .|||.         |..|.|.||  .|| ||
    1062 KCLTRDLDQASMEAVVSLLAGLPLQ........PEEGDGVELMEAKSQLF 1103

    1582 GFYFNILMKGLEKSSDRDNYPV.......FLRHKMSVLNDNVILSLTNLS 1624
           ||.|||. ||.||| || ..        |.|||. |.. .||.|.|| 
    1104 LKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLASLRHCTVLAMSNLL 1153

    1625 NTNVDASLQFTLPMGYSGNRNIRNAFLEVFINIV...TNYRTYTAKTDLG 1671
         |.|||.||  .|.|||  | ..|..|||||..||   ||| |.....  |
    1154 NANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLAD 1203

    1672 KLEAADKFLRYTIEHPQLSSFG..AAVCPASDIDAYAAGLINAFETRNAT 1719
         |||   .||    ||.||.     |.|.|.|| |..| .||. ||.||  
    1204 RFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLL 1253

    1720 HIVVAQLIKNEIEKSSRPTDILRRNSCATRSLSMLARSKGNEYLIRTLQP 1769
         . || .||..||| ...  .||| || |.| |.|  |  |..|| | |||
    1254 YQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDP 1303

    1770 LLKKIIQNRDF....FEIE..KLKPEDSDAERQIELFVKYMNELLESISN 1813
         ||| || ..||    ||||  ||.|.|| .|.| ||| .  |.||..| .
    1304 LLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLL.QMTEKFFHAIIS 1352

    1814 SVSYFPPPLFYICQNIYK.....................VACEKFPDHAI 1842
         | | |||.|  ||| ||.                     |.|||||||.|
    1353 SSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSI 1402

    1843 IAAGSFVFLRFFCPALVSPDSENIIDISHLSE.KRTFISLAKVIQNIANG 1891
          |.|| |||||| |||||| ...||| .. .  .|.|  |.||||.||| 
    1403 GAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANH 1452

    1892 SENFSRWPALCSQKDFLKECSDRIFRFLAELCRTDRTIDIQVRTDPTPIA 1941
            |.| . | . .||||.  |   ||| ||... .|      .||.  .
    1453 VL.FTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPT......SDAVNHS 1495

    1942 FDYQFLHSFVYLYGLEVRRNVLNEAKHDDGDIDGDDFYKTTFLLIDDVLG 1991
         |.|    ..| |. | ||.|  . |.. .|| | ... | .|  |..|||
    1496 LSFISDGNVLALHRL.LWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLA 1544

    1992 QLGQPKMEFSNEIPIYIREHMD.DYPELYEFMNRHAFRNIETSTA...YS 2037
          ||.|.    ..||   |. || . ..| |||.||..|| |. .|   .|
    1545 YLGPPE...HKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLS 1591

    2038 PSVHESTSSEGIPIITLTMSNFSDRHVDIDTVAYKFLQIYARIWTTKHCL 2087
            |.|||..| ||| .. ..|.. ||| | | |..| .. ..|.... |
    1592 IFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEI 1641

    2088 IIDCTEFDEGGLDMRKFISLVMGLLPEVAPKNCIGCYYFNVNETFMDNYG 2137
         ||| |. |.|.  . .|||  |.||||.| .|. |.|.||.| .|| ||.
    1642 VVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCN.SWVREYT 1690

    2138 KCLDKDNVYVSSKIPHYFINSNSDEGLMKSVG.....ITGQGLKVLQDIR 2182
         || ||  |..| | .. ||  ||.| | . ||     |.|..| | ||||
    1691 KYHER..LLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLK 1738

    2183 VSLHDITLYDEKRNRFTPVSLKIGDIYFQVLHETPRQYKIRDMGTLFDVK 2232
         |  |.|.| ...    |.||||||.. .||  ..| . || | |.|    
    1739 VFHNALKLAHKD....TKVSIKVGSTAVQV..TSAERTKVLGQSVF.... 1778

    2233 FNDVYEISRIFEVHVSSITGVAAEFTVTF.QDERRLIFSSPKYLEIVKMF 2281
         |||||  | | || | .    ..|||||| .|| .|.|  ..| .||. |
    1779 LNDIYYASEIEEICLVD....ENQFTLTIANQGTPLTFMHQECEAIVQSI 1824

    2282 YYAQIRLESEYEMDNNSSTSSPNSNNKDKQQKERTKLLCHLLLVSLIGLF 2331
         .. ..|||           | |||  .... |.| .| . || |.||.| 
    1825 IHIRTRWE..........LSQPDSIPQHTKIRPK.DVPGTLLNIALLNLG 1863

    2332 DESKKMKNSSYNLIAATEASFGLNFGSHFHRSPEVYVPEDTTTFLGVIGK 2381
         .....||...||||.| ...|.|.|||||  ..|||||.|.| ||. |||
    1864 SSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISK 1913

    2382 SLAESNPELTAYMFIYVLEALKNNVI..PHVYIPHTICGLSYWIPNLYQH 2429
         .||..||.||  ||  .|.||... |  .||||.. .. || ||. ||.|
    1914 TLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVR.FCKH 1962

    2430 VYLADDEEGPENISHIFRILIRLSVRETDFKAVYMQYVWLLLLDDGRLTD 2479
             |||. .|.|. ||  || |.|.|.|| | . . ||  | | . | |
    1963 ....NDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLD 2008

    2480 IIVDEVINH....ALERDSENRDWKKTISLLTV...LPTTEVANNIIQKI 2522
         ||||..|.     |||. ..|   ...|.| ..   |....| ..|.. |
    2009 VVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKII 2058

    2523 LAKIRSFLPSLKLEAMTQSWSELTILVKISIHVFFETSLLVQMYLPEILF 2572
           .. |  |.|. . |   |.||.||.|. | | ||.|| |. .|| || 
    2059 DKTCLSPTPTLEQHLM...WDDIAILARYMLMLSFNNSLDVAAHLPYLFH 2105

    2573 IVSLLIDVGPRELRSSLHQLLMNVCHSLAINSAL..PQDHRNNLDEISDI 2620
         ||.|||..|| .||.| |.|||||.|||.. |.|  .|| |. |    . 
    2106 VVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLRLSLTE 2155

    2621 FAHQKVKFMFGFSEDKGRIL.........QIFSASSFASK...FNILDFF 2658
         |. .|. ||||||. ||  |         . ||||||...   |. || .
    2156 FSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETV 2205

    2659 INNILLLME.YSSTYEANVWKTRYKKYVLESVFTSNSFLSARSIMIVGIM 2707
         .|.|| ||| | .....  | ..|....   .|  |. | ||.|||.|.|
    2206 TEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCI 2255

    2708 GKSYITEGLCKA...MLIETMKVIAEPKITDEHLFLAISHIFTYSKIVEG 2754
         ||. |..| .|.   || ..|. . ... | |  .|  . ||...|| . 
    2256 SKR.VSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQPL 2304

    2755 LDPNLDLMKHLFWFSTLFLESRHPIIFEGALLFVSNCIRRL......... 2795
         ||.| .| | |||... .||  .. ||.||  ||.. || |         
    2305 LNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDK 2354

    2796 .....YMA..................QFENESETSLISTLLKG....... 2815
              |||                  .||.| | .||| ||||       
    2355 SPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPA 2404

    2816 .....RKFAHTFLSKIENLSGIVWNEDNFTHILIFIINKGLSNPFIKSTA 2860
               || ||||. ||. ... . | |   | .|    .|||.. ....
    2405 IVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCS 2454

    2861 FDFLKMMF..........RNSYFEHQINQK...............SDHYL 2885
         |.  | ||          .|.|  || |..               || ||
    2455 LKHRKSLLLTDISMENVPMDTYPIHHGDPSYRTLKETQPWSSPKGSEGYL 2504

    2886 CYMFLLY.........................FVLNCNQFEELLGDV... 2907
         .  |                            || . . ||.||||.   
    2505 AATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAP 2554

    2908 ...DFEGEMVNIENKNTIPKILLE....WLSSDNENAN...ITLYQGAIL 2947
            ||||||.. .... ||.. .|    ||||..||||   |.| ||.||
    2555 KRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVL 2604

    2948 FKCSVTDEPSRFRFAL.................IIRHLLTKKPICALRFY 2980
         |. .| .||.   | |                 || ..|.. .|.  |.|
    2605 LDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVF 2654

    2981 SVIRN....EIRKISAFEQNSDCVPLAFDILNLLVTHSESNS......LE 3020
         .||||    .|..| .| ||.| |    |||. || |.|| .      ||
    2655 PVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQ 2704

    3021 KLHEESIERLT...KRGLSIVTSSGIFAKNSDMMIP..LDVKPEDIYERK 3065
         .|  ||| ||.   .|.  |.. .|||.|  | ||.  |.. .||. | .
    2705 SFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEES 2754

    3066 RIM......TMILSRMSCSA.............................. 3079
          |       . | |.||..|                              
    2755 LLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPT 2804