Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 3.8e-255
Percent Similarity (|+|): 64.7    Percent Identity (|): 43.0


       1 MSSTRPELKFSDVSEERNFYKKYTGLPKKPLKTIRLVDKGDYYTVIGSDA 50
         |.  ..|    | ..| .| | | |||.|| .||||.|||||||. |.||
       1 MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDA 50

      51 IFVADSVYHTQSVLKNCQLDPVTAKNFHEPTKYVTVSLQVLATLLKLCLL 100
         ||.| .||.||||||   |||..|||||.    |.||   |..|||  ||
      51 LLAAREVFKTQGVIKY..MGPAGAKNLQS....VVLSKMNFESFVKDLLL 94

     101 DLGYKVEIY..........DKGWKLIKSASPGNIEQVNELMNMNIDSSII 140
           .||||||          |.|| |  .||||||.|.||||  | | |  
      95 VRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSAS 144

     141 IASLKVQWNSQDGNCIIGVAFIDTTAYKVGMLDIVDNEVYSNLESFLIQL 190
         || | |. .. ||.  |||||||... |||| ||.||| |||||.|||||
     145 IGVVGVKMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQI 194

     191 GVKECLVQDLTSNSNSNAEMQKVINVIDRCGCVVTLLKNSEFSEKDVELD 240
         |.|||||.|    ||..|||.|| .||||.|.|||  |..|||.|||  |
     195 GPKECVLPG....GETAGDMGKLRQIIQRGGILITERKKADFSTKDIYQD 240

     241 LTKLL....GDDL.ALSLPQKYSKLSMGACNALIGYLQLLSEQDQVGKYE 285
         |.|||    |||| .  |||. ..|.||. .||| ||||||||...|.||
     241 LNRLLKGKKGEQMNSAVLPEMENQVAVSSLSAVIKFLELLSDDSNFGQFE 290

     286 LVEHKLKEFMKLDASAIKALNLFPQGPQNPFGSNNLAVSGFTSAGNSGKV 335
         |.. .|.|||||| .||||||||..|.||. ||..||             
     291 LTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLA............. 327

     336 TSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYLIDQIELR 385
             .|||.||| .| ||||||||||| | | ||.| |||| |||| |||
     328 ....ALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELR 373

     386 QMLTSEYLPMIPDIRRLTKKLNKR.GNLEDVLKIYQFSKRIPEIVQVFTS 434
         | | .|.|..||||.||.|||.|. |||||..||||  ..||||||.|  
     374 QTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQAL.. 421

     435 FLEDDSPTEPVNELVRSVWLAPLSHHVEPLSKFEEMVETTVDLDAYEENN 484
             |...|. ..|| .|||.||..  ..|||||||||||||||.  |||
     422 ....EKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQV.ENH 466

     485 EFMIKVEFNEELGKIRSKLDTLRDEIHSIHLDSAEDLGFDPDKKLKLENH 534
         |||||..||.|||.||. ||.| ..|||. |..| ||||||||.||||. 
     467 EFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSS 516

     535 HLHGWCMRLTRNDAKELRKHKKYIELSTVKAGIFFSTKQLKSIANETNIL 584
            ||||||| .|.| ||.||.| .|.. |.|| |....|.||.|| .  
     517 AQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKN 566

     585 QKEYDKQQSALVREIINITLTYTPVFEKLSLVLAHLDVIASFAHTSSYAP 634
         ..|||..|.|||||||||. .|...||.|. ||||||.|.||||.|. ||
     567 KTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAP 616

     635 IPYIRPKLHPMDSERRTHLISSRHPVLEMQDDISFISNDVTLESGKGDFL 684
         |||||| | . .|| |. | .||||.|||||||.||.||| ||.||. | 
     617 VPYVRPAILE.KGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFH 665

     685 IITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAG 734
         ||||||||||||||||.||| ||||||||||||.|||.|||.||.|||||
     666 IITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAG 715

     735 DSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTYDGFGLAWA 784
         |||||||||||.||||||||||.|.|||||||||||||||||||||||||
     716 DSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWA 765

     785 IAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKEQKH 834
         |.|.||.|||.|.||||||||||.|.|.||.|.||||.| .         
     766 ISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALT......... 806

     835 DDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELDDLKT 884
         .||.|||||.|..||||||||||||||..||..||. ||.|| |||||. 
     807 TEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQY 856

     885 NNEDL......KKAKLSLQEVNEGNIRLKALLKEWIRKVKEEGLHDPSKI 928
          .|.       . || |. | ||||     ||.|||.|||| .|      
     857 IGESQGYDIMEPAAKKCYLEREQGE....KIIQEFLSKVKQMPF...... 896

     929 TEEASQHKIQELLRAIANEPEKENDNYLKYIKALLL.... 964
          .| ||..|   ||.| .|.  .||.||. | . |     
     897 .TEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT* 935