Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 3.1e-92 
Percent Similarity (|+|): 81.9    Percent Identity (|): 71.5



       1 MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD 50
               ..||||||||||||||||||||||||||||||||||||||||||
       1 .....MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD 45

      51 VEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENV 100
         ||||||.||||||||||||||||||||||||.|||||||||| |||||||
      46 IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENI 95

     101 QEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQ 150
         .|||.||| |||..||||||| | |||||.||  || .  ||||..|||.
      96 PEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGR 145

     151 SVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTE 200
         .|||.||| || ||||||  ||||||| ||||.| ||.           |
     146 DMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARR...........G 184

     201 KKKKKCVLL. 209
         |||. |||| 
     185 KKKSGCLVL* 194