Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 4.5e-21
Percent Similarity (|+|): 65.5    Percent Identity (|): 37.4


       1 MSNTLFDDIFQVSEVDPG..RYNKVCRIEAASTTQDQCKLTLDINVELFP 48
         |...||||||||.|||||  ||||||||...|.. .  .|.|||||||||
       1 MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKM.DLILDVNIQIYP 49

      49 VAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMY 98
         |. .|.| |.|||.|  ||| .||. .      | .| .| |||||||||
      50 VDLGDKFRLVIASTLYEDGTLDDGEYN......PTDDRPSRADQFEYVMY 93

      99 GTAYKFE..EVSKDL...IAVYYSFGGLLMRLEGNYRNLNNLKQEN.AYL 142
         |..||||  |.|.|    |..| |||||||||||| .|||.|. |. .||
      94 GKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYL 143
                 
     143 LIRR.... 146
         ||||    
     144 LMKKLAF* 151