Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 3.1e-50
Percent Similarity (|+|): 33.9    Percent Identity (|): 23.9


     151 LGSRNNNKSVIDNSSIGKQLENDIKLEVIRLQGSLIMALKEQSK..LLLQ 198
                              || |||    |      |  |||   | |
       1 ....................MSEKKLETTAQQRKCPEWMNVQNKRCAVEE 30

     199 KCSIIESTSLSEDAKRLQLSRDI..RPQLSNMSIRIDSLEKEIIKAKKDG 246
         | | |  |   ||   || |  |      || |   | |   |      |
      31 RKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVG 80

     247 MSKDQSKGRSQVSSQDDNIISSILPSPLEYNTSSRNSNLTSTTATTVTKA 296
            |     ||       ||   |     |     | ||       | | 
      81 FDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLEN 130

     297 LAITGAKQNITNNTGKNSNN.DSNNDDLIQVLD.DEDDIDCDPPVILKEG 344
          ||  |   |  |  |   | |    | ||| |     | |     |   
     131 KAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL 180

     345 APHSPAFPHLHMTS...........EEQDELTRRRNMRSREPVNYRIPDR 383
           |      |   |            |  ||    |  |   |   |   
     181 VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEIL 230

     384 DDPFD.YVMGKSLRDDYPDVEREEDELTMEAEDDA.HSSYMTTRDEEKEE 431
         ||    | | |       || ||   || |  | | |  |  || |    
     231 DDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRR 280

     432 NELLNQSDFDFVVNDDLDPTQDTDYHDNMDVSANIQESSQEGDTRSTITL 481
           || |   | | |        ||    |  | ||   | |  |   |  
     281 VSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQ 330

     482 SQNKNVQVILS......SPTAQSVPSNGQNQIGVEHIDLLEDDLEKDAIL 525
          | |  ||||        ||   |  |    |    ||  ||  | | | 
     331 KQIREHEVLIHVEDETWDPTLDHLAKHDGEDVLGNKVERKEDGFE.DGVE 379

     526 DDSMSFSFGR...QHMPMSHSDLELIDSE...........KENEDFEEDN 561
         || |  |  |     | ||  |||||| |           |  |    ||
     380 DNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYKSTEHLSPND 429

     562 NNNGIEYL..SDSDLE....RFDEERENRTQVADIQELDNDLKIITERKL 605
         | |   ||  || |||    |     ||    | | | | ||||   | |
     430 NENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSL 479

     606 TGDNEHPPPSWSPKIKREKSSVSQKDEEDDFDDDFSLSDIVSKSNLSSKT 655
            |         |  | | ||    |||| |||   ||     |     
     480 ENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLW 529

     656 NGPTYPWSDEVLYRLHEVFKLPGFRPNQLEAVNATL.QGKDVFVLMPTGG 704
           |    ||| |  |   |    ||| | | ||| | | ||   || || 
     530 PAP....NEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGY 575

     705 GKSLCYQLPAVVKSGKTHGTTIVISPLISLMQDQVEHLLNKNIKASMFSS 754
         ||||||| | |   ||     ||||||||||||||  |   || |     
     576 GKSLCFQYPPVY.VGK...IGLVISPLISLMEDQVLQLKMSNIPACFL.. 619

     755 RGTAEQRRQTFNLFINGLLDLVYISPEMISASEQCKRAISRLYADGKLAR 804
          ||||      || | |   |||||||  | |      | || ||  |  
     620 .GSAQSENVLTDIKL.GKYRIVYVTPEYCSGN...MGLLQQLEADIGITL 664

     805 IVVDEAHCVSNWGHDFRPDYKELKFFKREYPDIPMIALTATASEQVRMDI 854
         | |||||||| ||||||  ||||   |   | |||||||||||  || ||
     665 IAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDI 714

     855 IHNLELKEPVFLKQSFNRTNLYYEVNKKTKNTI.....FEICDAVKSRFK 899
         |  | || |      ||| ||| || ||| | |     | |  |    ||
     715 VRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFE 764

     900 NQTGIIYCHSKKSCEQTSAQMQRNGIKCAYYHAGMEPDERLSVQKAWQAD 949
           | |||| |||  || | ||||  | |  |||||    |  |   |  |
     765 GPT.IIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRD 813

     950 EIQVICATVAFGMGIDKPDVRFVYHFTVPRTLEGYYQETGRAGRDGNYSY 999
         ||| | ||||||||||| ||| | ||  || || |||| |||||||  | 
     814 EIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSS 863

    1000 CITYFSFRDIRTMQTMIQKDKNLDRENKEKHLNKLQQVMAYCDNVTDCRR 1049
         |   ||  ||   | || | ||   |    |  ||   |    | | |||
     864 CHVLWAPADINLNRHLLTEIRN...EKFRLYKLKMMAKMEKYLHSSRCRR 910

    1050 KLVLSYFNEDFDSKL......CHKNCDNCRNSA....NVINEERDVTEPA 1089
         ||||||| |    |         | ||||||      || | |    |  
     911 QIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFG 960

    1090 KKIVKLVESIQ..NERVTIIYCQDVFKGSRSSKIVQANHDTLEEHGIGKS 1137
          |  ||| ||    ||  |       ||| | ||    |      | || 
     961 PQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLAD.QYRRHSLFGTGKD 1009

    1138 MQKSEIERIFFHLITIRVLQEYSIMNNSGFASSYVKVGPN........AK 1179
           ||  |     |||   | | |  |      |  | | |        ||
    1010 QTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQ 1059

    1180 KLLTGKMEIKMQFTISAPNSRPSTSSSFQANEDNIPVIAQKSTTIGGNVA 1229
          ||    |         ||||  || | |   | |||  | ||    || 
    1060 SLILQANEELCPKKFLLPSSKTVSSGTKEHCYNQVPV..ELSTEKKSNLE 1107

    1230 ANPPRFISAKEHLRSYTYGGSTMGSSHPITLKNTSDLRSTQELNNLRMTY 1279
                  |    |     | |  |      ||  | | ||     | |
    1108 KLYSYKPCDKISSGSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLY 1157

    1280 ERLRELSLNLGNRMVPPVGNFMPDSILKKMAAILPMNDSAFATLGTVEDK 1329
          || |      |||  |      | ||  || | |        |  | | 
    1158 GKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEG 1207

    1330 YRRRFKYFKATIADLSKKRSSEDHEKYDTILNDEFVNRAAASSNGIAQST 1379
                    |    |  | |  | | |    |    |  | | |    
    1208 KAAMLAPLLEVIKHFCQTNSVQT.DLFSSTKPQEEQKTSLVAKNKIC... 1253

    1380 GTKSKFFGANLNEAKENEQIINQIRQSQLPKNTTSSKSGTRSISKSSKKS 1429
          | ||      |  || |  |  | ||||    |     ||||       
    1254 .TLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLD 1302

    1430 ANGRRGFRNYRGHYRGRK................................ 1447
            | |                                            
    1303 LE.RAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMA 1351