Alignment table

Needleman Wunsch alignment of:

(Yeast sequence on top).
BLAST P-value: 8.9e-56
Percent Similarity (|+|): 69.3    Percent Identity (|): 54.9


       1 .MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIH 49
           ..||.||||||.| |||.||| ...||..|. .| |  .|| ||||||
       1 MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKG.LTEGLHGFHVH 49

      50 EFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGS 99
         ||||.|.||.|||||||||.|.||||.|| |||||||||..|.||||..|
      50 EFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVS 99

     100 FKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGV 149
         |.||||.| |. |||||.||||. .|||||||.||| ||||||.| ||||
     100 IEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGV 149
               
     150 IGLTN. 154
         |||.. 
     150 IGIAQ* 155