Alignment table

Smith-Waterman* alignment of:

(Yeast sequence on top).
BLAST P-value: 8.8e-84
Percent Similarity (|+|): 48.6   Percent Identity (|): 35.6



    2198 RHYNRVLLQYNRDSEVLKALLLQKEKFLWHALHFYLNTLVFSNRYDNDII 2247
         ||  ||  |   |   ||||   |||||  ||  ||| ||    ||  | 
    2436 RYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVF 2485

    2248 DKFCGLWFENDDNSKINQLLYKEIGTIPSWKFLPWVNQIASKIS...MEE 2294
          | | || ||   |||| || ||   |||||||| | ||||||    |  
    2486 .RLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGG 2534

    2295 NEFQKPLQLTMKRLLYKLPYDSLYSVMSILLYEK.QSNKDTNISQKIQAV 2343
           | | |   | ||    || ||| ||||    | |      |||| |  
    2535 LGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRIT 2584

    2344 KKILLELQGYDRG.............AFAKKYLLPVQEFCEMSVELANLK 2380
         | |  |    |               |   | |  ||  ||  | |||| 
    2585 KNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLD 2634

    2381 FVQNTKTLRLANLKIGQYWLKQLNMEKLPLPTSNFTVKSSADGRKARPYI 2430
           |     |  ||   |   |  ||| | |||    ||    |       
    2635 ATQWKTQRKGINIPADQPITKLKNLEDVVVPT..MEIKVDHTGEYGNLVT 2682

    2431 VSVNETVGITTTGLSLPKIVTFNISDGTTQKALMKGSNDDLRQDAIMEQV 2480
         |   |       ||||||||    |||  || ||||  ||||||||||||
    2683 IQSFKAEFRLAGGVNLPKIIDCVGSDGKERRQLVKG.RDDLRQDAVMQQV 2731

    2481 FQQVNKVLQNDKVLRNLDLGIRTYKVVPLGPKAGIIEFVANSTSLHQIL. 2529
         ||  | ||| |   |   | | |||||||  |||||||   |  | | | 
    2732 FQMCNTLLQRNTETRKRKLTICTYKVVPLSQRSGVLEWCTGTVPIGEFLV 2781

    2530 ......SKLHTNDKITFDQARKGMKAVQTKSNEERLKAYLKITNEIKPQL 2573
                | |  |  |  | || |  || || ||| | || |    ||  
    2782 NNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVFMDVCQNFQPVF 2831

    2574 RNFFFDSFPDPLDWFEAKKTYTKGVAASSIVGYILGLGDRHLNNILLDCS 2623
         | |  | | ||  ||| |  ||| || ||||||||||||||| |||||  
    2832 RYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINEQ 2881

    2624 TGEPIHIDLGIAFDQGKLLPIPELVPFRLTRDIVDGFGVTGVDGLFRRSC 2673
         | | |||||||||||||||| || |||||||||||| ||||||||||| |
    2882 SAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCC 2931

    2674 ERVYAVLRKDYVKVMCVLNILKWDPLYSWVMSPVKK..YEHLFEEE...H 2718
         ||   |||     || || || ||||| | |||||    |   |||   |
    2932 EKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELH 2981

    2719 EITNFDN..VSKFISNNDRNENQESYRALKGVEEKLM....GNGLSVESS 2762
            | ||    | ||| ||| || | | |  |||||     |  |||   
    2982 PTLNADDQECKRNLSDIDQSFDKVAERVLMRLQEKLKGVEEGTVLSVGGQ 3031

    2763 VQDLIQQATDPSNLSVIYMGW 2783
         |  ||||| || ||| || ||
    3032 VNLLIQQAIDPKNLSRLFPGW 3052





*Smith-Waterman alignment was used for this comparison due to difficulty in using the Needleman-Wunsch algorithm owing to an "uncooperative" GCG gap program. Stay tuned.