back Return to this vector's summary.
This sequence was contributed to VectorDB by:
     
 Address: Ferenc Felfoldi
          Institute of Enzymology
          Biological Research Center
          Hungarian Academy of Sciences
          H-1518 Budapest, P.O. Box 7
          Hungary     
          Email: felfoldi@enzim.hu    
 
-----------------------------------------------------------------------------


LOCUS    PBS42      preliminary; circular DNA; SYN; 4594 BP.
        ATCC37279;
DEFINITION    Bacillus/E.coli cloning vector pBS42, complete genom.
KEYWORDS    chloramphenicol resistance; cloning vector.
SOURCE      Cloning vector plasmid pBS42 
  ORGANISM  Cloning vector
            Artificial sequences; Cloning vehicles.
REFERENCE   1 
  AUTHORS   Band L., Henner D.J.;
  TITLE     Bacillus subtilis requires a stringent Shine-Dalgarno region
            for gene expression
  JOURNAL   DNA 3:17-21(1984).

  Created by Felfoldi F., November 1995,

  A Bacillus subtilis/E.coli shuttle vector.
  Medium is 1675 LB plus chloramphenicol (10 ug/ml).

  Host:(Bacillus subtilis)(E.coli)
  Source: pUB110 (m19465.gb_ba);pC194 (j01754.gb_ba);pBR322 (j01749.gb_sy)
  /note="1. pUB110 BamHI-HpaII 2588 bp 1..792 and 2752..4548, origin
        :bamHI blunt end
        2. pBR322 PvuII-Sau3A/MboI 973 bp 2067..3039, origin
        3. pC194 Sau3A/MboI-HpaII 1033 bp 976..2008, cat
                   -> pBS42 4594bp"
   -               1..792 and 2799-4594
                   /note="pUB110 1..792 and 2752..4548 2588bp
                   BamHI =   G^GATCC
                   PvuII = CAG^CTG"
   -               793..1765
                   /note="pBR322 2067..3039 973bp
                   MboI = Sau3AI = ^GATC"
   -               1766..2798
                   /note="pC194 976..2008 1033bp
                   HpaII = C^CGG"
   rep_origin      1261
                   /note="ORI E. coli pMB1 (ColE1 and pBR322)"
             
  CDS  complement(2514. .1864)
       /note="chloramphenicol acetyl transferase (gene B);  NCBI gi: 150549"
       /codon_start=1
       /transl_table=11
       /translation="MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQ
       EGYKFYPAFIFLVTRVINSNTAFRTGYNSDGELGYWDKLEPLYTIFDGVSKTFSGIWT
       PVKNDFKEFYDLYLSDVEKYNGSGKLFPKTPIPENAFSLSIIPWTSFTGFNLNINNNS
       NYLLPIITAGKFINKGNSIYLPLSLQVHHSVCDGYHAGLFMNSIQELSDRPNDWLL"

ORIGIN 1bp upstrame of EcoRI site.

SQ   Sequence 4594 BP; 1291 A;  988 C; 741 G; 1574 T; 0 other;
     GAATTCCTTA GTGCTTTCAT AGATTAAACT CACATCACGC TTTAAATCGC TTATTTTAGA
     CTTTAAAGAC TTGTTTTCTT CAAGCAACTC ATTATAATCA TTTACATTTT CATTAAATCG
     CTCTACAAGA CCACTATATT TTTCTTTAAC TTGCCCATGT TCTTTACTTA ATTTTTTATA
     TTCTCTCGCC ATATCAGTAC TCATGAGATT TCTAACATGC TGTTTTAACC TATCGTTATC
     TCTCGCAGCA GTCACTAAGT TTTTATAATC ACGCTCCGAT ATAACAACAT TTTTGGTTGG
     TTTCTTTTCT GTTTTCATTA TTTCTTTTCC CAAACCAAAC ATGGACTTTT CACCCGTTGG
     CACTTCAACA CTTTTCATGT GTCGTTTCGC TGGTACTTCT AAATCTGATT TAACTTTATC
     GCTATAAGCA GTCCATTCAT CTTTTTTAAC TGCTAAATTT TTTTCTAGAA AATCAATCTC
     TTTTTCCAAA GTTTGTTTTT TAAATTTAGC TGTCTCAATA TGTTTACGGT CAGAGCCACG
     TTCACCACGC TTCAACTCAA AACCCTGTTT TTTCATATGC TCGGGGAATT TATCTTGTAG
     CCATAACAGT TCTTGACGAT TAAACACATT TTTTCCTTGC AGTTTTCCAT CACGCATAGG
     CACAACACCT AAATGCATGT GAGGGGTTTG CTCATCATTA TGAACTGTTG CATAAGCAAT
     ATTTTGCTTG CCATATCGTT CGGAAAATAA TTTATAACTT TCCTCAAAAA ATCGTTTTTG
     TTCTCCTGGA TCCTGCCTCG CGCGTTTCGG TGATGACGGT GAAAACCTCT GACACATGCA
     GCTCCCGGAG ACGGTCACAG CTTGTCTGTA AGCGGATGCC GGGAGCAGAC AAGCCCGTCA
     GGGCGCGTCA GCGGGTGTTG GCGGGTGTCG GGGCGCAGCC ATGACCCAGT CACGTAGCGA
     TAGCGGAGTG TATACTGGCT TAACTATGCG GCATCAGAGC AGATTGTACT GAGAGTGCAC
     CATATGCGGT GTGAAATACC GCACAGATGC GTAAGGAGAA AATACCGCAT CAGGCGCTCT
     TCCGCTTCCT CGCTCACTGA CTCGCTGCGC TCGGTCGTTC GGCTGCGGCG AGCGGTATCA
     GCTCACTCAA AGGCGGTAAT ACGGTTATCC ACAGAATCAG GGGATAACGC AGGAAAGAAC
     ATGTGAGCAA AAGGCCAGCA AAAGGCCAGG AACCGTAAAA AGGCCGCGTT GCTGGCGTTT
     TTCCATAGGC TCCGCCCCCC TGACGAGCAT CACAAAAATC GACGCTCAAG TCAGAGGTGG
     CGAAACCCGA CAGGACTATA AAGATACCAG GCGTTTCCCC CTGGAAGCTC CCTCGTGCGC
     TCTCCTGTTC CGACCCTGCC GCTTACCGGA TACCTGTCCG CCTTTCTCCC TTCGGGAAGC
     GTGGCGCTTT CTCATAGCTC ACGCTGTAGG TATCTCAGTT CGGTGTAGGT CGTTCGCTCC
     AAGCTGGGCT GTGTGCACGA ACCCCCCGTT CAGCCCGACC GCTGCGCCTT ATCCGGTAAC
     TATCGTCTTG AGTCCAACCC GGTAAGACAC GACTTATCGC CACTGGCAGC AGCCACTGGT
     AACAGGATTA GCAGAGCGAG GTATGTAGGC GGTGCTACAG AGTTCTTGAA GTGGTGGCCT
     AACTACGGCT ACACTAGAAG GACAGTATTT GGTATCTGCG CTCTGCTGAA GCCAGTTACC
     TTCGGAAAAA GAGTTGGTAG CTCTTGATCT GGAGCTGTAA TATAAAAACC TTCTTCAACT
     AACGGGGCAG GTTAGTGACA TTAGAAAACC GACTGTAAAA AGTACAGTCG GCATTATCTC
     ATATTATAAA AGCCAGTCAT TAGGCCTATC TGACAATTCC TGAATAGAGT TCATAAACAA
     TCCTGCATGA TAACCATCAC AAACAGAATG ATGTACCTGT AAAGATAGCG GTAAATATAT
     TGAATTACCT TTATTAATGA ATTTTCCTGC TGTAATAATG GGTAGAAGGT AATTACTATT
     ATTATTGATA TTTAAGTTAA ACCCAGTAAA TGAAGTCCAT GGAATAATAG AAAGAGAAAA
     AGCATTTTCA GGTATAGGTG TTTTGGGAAA CAATTTCCCC GAACCATTAT ATTTCTCTAC
     ATCAGAAAGG TATAAATCAT AAAACTCTTT GAAGTCATTC TTTACAGGAG TCCAAATACC
     AGAGAATGTT TTAGATACAC CATCAAAAAT TGTATAAAGT GGCTCTAACT TATCCCAATA
     ACCTAACTCT CCGTCGCTAT TGTAACCAGT TCTAAAAGCT GTATTTGAGT TTATCACCCT
     TGTCACTAAG AAAATAAATG CAGGGTAAAA TTTATATCCT TCTTGTTTTA TGTTTCGGTA
     TAAAACACTA ATATCAATTT CTGTGGTTAT ACTAAAAGTC GTTTGTTGGT TCAAATAATG
     ATTAAATATC TCTTTTCTCT TCCAATTGTC TAAATCAATT TTATTAAAGT TCATTTGATA
     TGCCTCCTAA ATTTTTATCT AAAGTGAATT TAGGAGGCTT ACTTGTCTGC TTTCTTCATT
     AGAATCAATC CTTTTTTAAA AGTCAATATT ACTGTAACAT AAATATATAT TTTAAAAATA
     TCCCACTTTA TCCAATTTTC GTTTGTTGAA CTAATGGGTG CTTTAGTTGA AGAATAAAGA
     CCACATTAAA AAATGTGGTC TTTTGTGTTT TTTTAAAGGA TTTGAGCGTA GCGAAAAATC
     CTTTTCTTTC TTATCTTGAT AATAAGGGTA ACTATTGCCG GTTGTCCATT CATGGCTGAA
     CTCTGCTTCC TCTGTTGACA TGACACACAT CATCTCAATA TCCGAATAGG GCCCATCAGT
     CTGACGACCA AGAGAGCCAT AAACACCAAT AGCCTTAACA TCATCCCCAT ATTTATCCAA
     TATTCGTTCC TTAATTTCAT GAACAATCTT CATTCTTTCT TCTCTAGTCA TTATTATTGG
     TCCATTCACT ATTCTCATTC CCTTTTCAGA TAATTTTAGA TTTGCTTTTC TAAATAAGAA
     TATTTGGAGA GCACCGTTCT TATTCAGCTA TTAATAACTC GTCTTCCTAA GCATCCTTCA
     ATCCTTTTAA TAACAATTAT AGCATCTAAT CTTCAACAAA CTGGCCCGTT TGTTGAACTA
     CTCTTTAATA AAATAATTTT TCCGTTCCCA ATTCCACATT GCAATAATAG AAAATCCATC
     TTCATCGGCT TTTTCGTCAT CATCTGTATG AATCAAATCG CCTTCTTCTG TGTCATCAAG
     GTTTAATTTT TTATGTATTT CTTTTAACAA ACCACCATAG GAGATTAACC TTTTACGGTG
     TAAACCTTCC TCCAAATCAG ACAAACGTTT CAAATTCTTT TCTTCATCAT CGGTCATAAA
     ATCCGTATCC TTTACAGGAT ATTTTGCAGT TTCGTCAATT GCCGATTGTA TATCCGATTT
     ATATTTATTT TTCGGTCGAA TCATTTGAAC TTTTACATTT GGATCATAGT CTAATTTCAT
     TGCCTTTTTC CAAAATTGAA TCCATTGTTT TTGATTCACG TAGTTTTCTG TATTCTTAAA
     ATAAGTTGGT TCCACACATA CCAATACATG CATGTGCTGA TTATAAGAAT TATCTTTATT
     ATTTATTGTC ACTTCCGTTG CACGCATAAA ACCAACAAGA TTTTTATTAA TTTTTTTATA
     TTGCATCATT CGGCGAAATC CTTGAGCCAT ATCTGACAAA CTCTTATTTA ATTCTTCGCC
     ATCATAAACA TTTTTAACTG TTAATGTGAG AAACAACCAA CGAACTGTTG GCTTTTGTTT
     AATAACTTCA GCAACAACCT TTTGTGACTG AATGCCATGT TTCATTGCTC TCCTCCAGTT
     GCACATTGGA CAAAGCCTGG ATTTACAAAA CCACACTCGA TACAACTTTC TTTCGCCTGT
     TTCACGATTT TGTTTATACT CTAATATTTC AGCACAATCT TTTACTCTTT CAGCCTTTTT
     AAATTCAAGA ATATGCAGAA GTTCAAAGTA ATCAACATTA GCGATTTTCT TTTCTCTCCA
     TGGTCTCACT TTTCCACTTT TTGTCTTGTC CACTAAAACC CTTGATTTTT CATCTGAATA
     AATGCTACTA TTAGGACACA TAATATTAAA AGAAACCCCC ATCTATTTAG TTATTTGTTT
     AGTCACTTAT AACTTTAACA GATGGGGTTT TTCTGTGCAA CCAATTTTAA GGGTTTTCAA
     TACTTTAAAA CACATACATA CCAACACTTC AACGCACCTT TCAGCAACTA AAATAAAAAT
     GACGTTATTT CTATATGTAT CAAGATAAGA AAGAACAAGT TCAAAACCAT CAAAAAAAGA
     CACCTTTTCA GGTGCTTTTT TTATTTTATA AACTCATTCC CTGATCTCGA CTTCGTTCTT
     TTTTTACCTC TCGGTTATGA GTTAGTTCAA ATTCGTTCTT TTTAGGTTCT AAATCGTGTT
     TTTCTTGGAA TTGTGCTGTT TTATCCTTTA CCTTGTCTAC AAACCCCTTA AAAACGTTTT
     TAAAGGCTTT TAAGCCGTCT GTACGTTCCT TAAG
//