back Return to this vector's summary.

NOTE : THE OLD VECTOR IG ENTRY PRECEDES THE NEW GENBANK ENTRY BELOW!!

ID   PINIIIOMP3 preliminary; circular DNA; SYN; 7500 BP.
XX
AC   IG5038;
XX
DT   01-OCT-1993 (Rel. 7, Created)
DT   01-JUL-1995 (Rel. 12, Last updated, Version 1)
XX
DE   E. coli plasmid vector pIN-III-ompA3 - incomplete.
XX
KW   cloning vector.
XX
OS   Cloning vector
OC   Artificial sequences; Cloning vehicles.
XX
RN   [1]
RC   pINIII-A1, pINIII-A2, pINIII-A3 from pINIII series
RC   pINIII-B1, pINIII-B2, pINIII-B3 from pINIII series
RC   pINIII-C1, pINIII-C2, pINIII-C3 from pINIII series
RC   pINIII-Omp1, pINIII-Omp2, pINIII-Omp3 from pINIII series
RA   Lunn C.A., Takahara M., Inouye M.;
RT   "Secretion cloning vectors for guiding the localization of proteins
RT   in vivo";
RL   Curr. Top. Microbiol. Immunol. 125:59-74(1986).
XX
RN   [2]
RC   pHG23 from human GM-CSF gene
RC   pLB5001 from pIN-III-ompA3 & linker & pHG23, human GM-CSF gene
RA   Libby R.T., Braedt G., Kronheim S.R., March C.J., Urdal D.L.,
RA   Chiaverotti T.A., Tushinski R.J., Mochizuki D.Y., Hopp T.P.,
RA   Cosman D.;
RT   "Expression and purification of native human
RT   granulocyte-macrophage colony stimulating factor from an Escherichia
RT   coli vector";
RL   DNA 6:221-229(1987).
XX
RN   [3]
RC   pIN-III-ompA3 from pINIII series & ompA3 gene
RA   Ghrayeb J., Kimura H., Takahara M., Hsiung H., Masui Y, Inouye M.;
RT   "Secretion cloning vectors in Escherichia coli";
RL   EMBO J. 3:2437-2442(1984).
XX
CC   MCS, oligonucleotide linker.
CC   NM (pIN-III-ompA3)
CC   CM (no)
CC   NA (ds-DNA)
CC   TP (circular)
CC   ST ()
CC   TY (plasmid)
CC   SP ()
CC   HO (E.coli)
CC   CP ()
CC   FN (cloning)
CC   SE ()
CC   PA (pIN-III from pIN from pBR322)
CC   BR (pIN-III-ompA1)(pIN-III-ompA2)
CC   OF (pRL6-6-87)
CC   OR ()
XX
FH   Key             Location/Qualifiers
FH
FT   misc_feature    0..0
FT                   /note="1. pINIII-A3 7400bp
FT                   2. E. coli ompA HhaI-HhaI 65bp, signal sequence
FT                   3. oligo, RBS
FT                   4. oligo, ompA signal peptide cleavage site
FT                   -> pIN-III-OmpA3 7500bp [unique EcoRI-HindIII-BamHI]"
FT   promoter        0..0
FT                   /note="PRO E. coli lpp gene & operator"
FT   promoter        0..0
FT                   /note="PRO E. coli lac gene"
FT   misc_binding    0..0
FT                   /note="SIT XbaI"
FT   misc_feature    0..0
FT                   /note="ompA signal sequence"
FT   misc_binding    0..0
FT                   /note="SIT EcoRI"
FT   misc_binding    0..0
FT                   /note="SIT HindIII"
FT   misc_binding    0..0
FT                   /note="SIT BamHI"
FT   CDS             0..0
FT                   /note="GEN E. coli beta-galactosidase gene (lacZ)"
FT   misc_binding    0..0
FT                   /note="SIT SalI"
FT   misc_binding    0..0
FT                   /note="SIT HincII"
FT   misc_binding    0..0
FT                   /note="SIT HincII"
FT   CDS             0..0
FT                   /note="REP E. coli lacI repressor gene"
FT   misc_binding    0..0
FT                   /note="SIT HpaI"
FT   rep_origin      complement(0..0)
FT                   /note="ORI E. coli pMB1 (ColE1 and pBR322)"
FT   CDS             complement(0..0)
FT                   /note="ANT E. coli beta-lactamase gene (bla)
FT                   ampicillin resistance gene (apr/amp)"
FT   misc_binding    0..0
FT                   /note="SIT PstI"
FT   misc_binding    0..0
FT                   /note="SIT HincII"
XX
SQ   Sequence 88 BP; 20 A; 22 C; 27 G; 19 T; 0 other;
     atgaaaaaga cagctatcgc gattgcagtg gcactggctg gtttcgctac cgtagcgcag
     gccggaattc caagcttgga tccggctg
//
LOCUS       CVU40577     7025 bp    DNA   circular  SYN       05-DEC-1995
DEFINITION  Secretion-expression vector pINIIIompA3, complete sequence.
ACCESSION   U40577
NID         g1101781
KEYWORDS    .
SOURCE      Cloning vector pINIIIompA3.
  ORGANISM  Cloning vector pINIIIompA3
            artificial sequence; cloning vectors.
REFERENCE   1  (sites)
  AUTHORS   Ghrayeb,J., Kimura,H., Takahara,M., Hsiung,H., Masui,Y. and
            Inouye,M.
  TITLE     Secretion cloning vectors in Escherichia coli
  JOURNAL   EMBO J. 3 (10), 2437-2442 (1984)
  MEDLINE   85051312
REFERENCE   2  (bases 1 to 7025)
  AUTHORS   Porter,T.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-NOV-1995) Todd D. Porter, College of Pharmacy,
            University of Kentucky, Lexington, KY 40536-0082, USA
COMMENT     This complete sequence was assembled from published sequences as
            well as from directly determined sequence information.  Assembly
            was based on the descriptions of plasmid constructions from the
            laboratory of Inouye (REFERENCE 1) and references cited therein.
            These sequences were directly determined:  the sequence of the
            lpp-lac promoter and ompA signal peptide, the lpp terminator region
            and the sequence up to the beginning of the lacI gene; the sequence
            following the lacI gene to the pBR sequence. The lacI gene sequence
            was extracted from GenBank, as was the pBR322 sequence.
FEATURES             Location/Qualifiers
     source          1..7025
                     /organism="Cloning vector pINIIIompA3"
                     /plasmid="pINIIIompA3"
                     /note="pBR322-based expression vector"
     promoter        1..391
                     /note="lpp-lac fusion promoter"
     sig_peptide     392..454
                     /gene="ompA"
                     /note="E. coli outer membrane protein A signal peptide"
     CDS             392..>454
                     /gene="ompA"
                     /note="E. coli outer membrane protein A signal peptide"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein A"
                     /db_xref="PID:g1101782"
                     /translation="MKKTAIAIAVALAGFATVAQA"
     misc_feature    456..474
                     /note="multiple cloning sites, EcoRI, HindIII, BamHI"
     terminator      477..758
                     /note="lpp gene transcription terminators"
     misc_feature    1353..2576
                     /note="lacI gene, encoding the lac repressor protein"
     CDS             1431..2513
                     /gene="lacI"
                     /codon_start=1
                     /transl_table=11
                     /product="lac repressor"
                     /db_xref="PID:g1101783"
                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAE
                     LNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERS
                     GVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
                     FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREG
                     DWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDT
                     EDSSCYIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNT
                     QTASPRALADSLMQLARQVSRLESGQ"
     rep_origin      4613..4804
                     /note="pBR322 origin of replication (ROP protein)."
     CDS             complement(5991..6851)
                     /codon_start=1
                     /function="provides resistance to ampicillin for selection
                     of plasmid-bearing recombinants"
                     /transl_table=11
                     /product="beta-lactamase"
                     /db_xref="PID:g1101784"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
BASE COUNT     1679 a   1872 c   1792 g   1682 t
ORIGIN      
        1 taggcgtatc acgaggccct ttggataacc agaagcaata aaaaatcaaa tcggatttca
       61 ctatataatc tcactttatc taagatgaat ccgatggaag catcctgttt tctctcaatt
      121 tttttatcta aaacccagcg ttcgatgctt ctttgagcga acgatcaaaa ataagtgcct
      181 tcccatcaaa aaaatattct caacataaaa aactttgtgt aatacttgta acgctacatg
      241 gagattaact caatctagct agagaggctt tacactttat gcttccggct cgtataatgt
      301 gtggaattgt gagcggataa caatttcaca caggaaacag ctatgaccat gattacggat
      361 tcactggaac tctagataac gagggcaaaa aatgaaaaag acagctatcg cgattgcagt
      421 ggcactggct ggtttcgcta ccgtagcgca ggccggaatt ccaagcttgg atccggctga
      481 gcaacgacgt gaacgcaatg cgttccgacg ttcaggctgc taaagatgac gcagctcgtg
      541 ctaaccagcg tctggacaac atggctacta aataccgcaa gtaatagtac ctgtgaagtg
      601 aaaaatggcg cacattgtgc gacatttttt ttgtctgccg tttaccgcta ctgcgtcacg
      661 cgtaacatat tcccttgctc tggttcacca ttctgcgctg actctactga aggcgcattg
      721 ctggctgcgg gagttgctcc actgctcacc gaaaccggat accctgcccg acgatacaac
      781 gctttatcga ctaacttctg atctacagcc ttattgtctt taaattgcgt aaagcctgct
      841 ggcagtgtgt atggcattgt ctgaacgttc tgctgttctc ctgccgatag tggtcgatgt
      901 acttcaacat aacgcatccc gttaggctcc acggaatatt tcaccggttc gttgatcact
      961 ttcaccggcg ttcccgtccg cacgctggag aacaaggctt taatatccgg tgcattcatg
     1021 cgaatacacc ctgaactgac gcgcaaaccg acgctgtccg gcgcactggt accatgaatg
     1081 aggtattcgc cattaccatg cgcgaggcgc agtgcgtaac gtcctagcgg gttatttggt
     1141 ccggcaggaa cgactggcgg taatttaatg ccacgctcca gcgaacgctg acgaatgcct
     1201 gccgtaggcg tccaggttgg gttagggatt ttctgcccaa cacgcgtttc catcaccggc
     1261 gtttccagcc cctgcaatcc aatacctatt ggataaacct gcacaatatt ttctcccggc
     1321 ggataataat aaaggcgcag ctctgcaagg ttgacaccat cgaatggcgc aaaacctttc
     1381 gcggtatggc atgatagcgc ccggaagaga gtcaattcag ggtggtgaat gtgaaaccag
     1441 taacgttata cgatgtcgca gagtatgccg gtgtctctta tcagaccgtt tcccgcgtgg
     1501 tgaaccaggc cagccacgtt tctgcgaaaa cgcgggaaaa agtggaagcg gcgatggcgg
     1561 agctgaatta cattcccaac cgcgtggcac aacaactggc gggcaaacag tcgttgctga
     1621 ttggcgttgc cacctccagt ctggccctgc acgcgccgtc gcaaattgtc gcggcgatta
     1681 aatctcgcgc cgatcaactg ggtgccagcg tggtggtgtc gatggtagaa cgaagcggcg
     1741 tcgaagcctg taaagcggcg gtgcacaatc ttctcgcgca acgcgtcagt gggctgatca
     1801 ttaactatcc gctggatgac caggatgcca ttgctgtgga agctgcctgc actaatgttc
     1861 cggcgttatt tcttgatgtc tctgaccaga cacccatcaa cagtattatt ttctcccatg
     1921 aagacggtac gcgactgggc gtggagcatc tggtcgcatt gggtcaccag caaatcgcgc
     1981 tgttagcggg cccattaagt tctgtctcgg cgcgtctgcg tctggctggc tggcataaat
     2041 atctcactcg caatcaaatt cagccgatag cggaacggga aggcgactgg agtgccatgt
     2101 ccggttttca acaaaccatg caaatgctga atgagggcat cgttcccact gcgatgctgg
     2161 ttgccaacga tcagatggcg ctgggcgcaa tgcgcgccat taccgagtcc gggctgcgcg
     2221 ttggtgcgga tatctcggta gtgggatacg acgataccga agacagctca tgttatatcc
     2281 cgccgtcaac caccatcaaa caggattttc gcctgctggg gcaaaccagc gtggaccgct
     2341 tgctgcaact ctctcagggc caggcggtga agggcaatca gctgttgccc gtctcactgg
     2401 tgaaaagaaa aaccaccctg gcgcccaata cgcaaaccgc ctctccccgc gcgttggccg
     2461 attcattaat gcagctggca cgacaggttt cccgactgga aagcgggcag tgagcgcaac
     2521 gcaattaatg tgagttagct cactcattag gcaccccagg ctttacactt tatgctaacg
     2581 ataatcccct gacgcggtgc atcaggtaat aacagttgtg aaggaatagt tatcgtcgta
     2641 ccaggttttg gcaccggggc gatagtgtta ttggcttcaa ggatcaacat tgccgcagta
     2701 tcaaaacgtc gggcaatagc ctgaaggttt ttatcccctt cttgcaccgt atacgtttga
     2761 ttttgcccaa ccagtcggct tccggttggt ggtagcggat aatcaaccgc ccaggcagcc
     2821 tggatggcgc taaaagcgcc gataagcgtg agtgtaagca aagacgcgcg tttcattgta
     2881 aacctcctgt atttgccgga gactcacgct gaaacgtcgg atggcgctta tgttcacctg
     2941 aaaccaaaac actcctgtgc aggtcagtgt aaacattgac catccggcaa tgtgagccaa
     3001 ccggatgaaa gctgtccttt tagtttagct aagtgcagcg gctttggcgc gaattgcgcg
     3061 aatcatcgct tccagacctt gtgaacgaga tggggtgaga tgttgggtga gcgccatttt
     3121 ttcaaaccac ggacgcacat cgaaattgac aatatcctgc ggcgtcatct gatcgtagag
     3181 aataaagacg accgcaataa gccctttcac aatcgccgca tcgctgtcgc cctgtaattc
     3241 aataattccc tgggcattct ggcgcatgac aatccacacc tgactctgac agccctgaat
     3301 gctattttgt ggacttctgt cttcgtcgcg taattctggc agacgctggg ggaccgatgc
     3361 ccttgagagc cttcaaccca gtcagctcct tccggtgggc gcggggcatg actatcgtcg
     3421 ccgcacttat gactgtcttc tttatcatgc aactcgtagg acaggtgccg gcagcgctct
     3481 gggtcatttt cggcgaggac cgctttcgct ggagcgcgac gatgatcggc ctgtcgcttg
     3541 cggtattcgg aatcttgcac gccctcgctc aagccttcgt cactggtccc gccaccaaac
     3601 gtttcggcga gaagcaggcc attatcgccg gcatggcggc cgacgcgctg ggctacgtct
     3661 tgctggcgtt cgcgacgcga ggctggatgg ccttccccat tatgattctt ctcgcttccg
     3721 gcggcatcgg gatgcccgcg ttgcaggcca tgctgtccag gcaggtagat gacgaccatc
     3781 agggacagct tcaaggatcg ctcgcggctc ttaccagcct aacttcgatc actggaccgc
     3841 tgatcgtcac ggcgatttat gccgcctcgg cgagcacatg gaacgggttg gcatggattg
     3901 taggcgccgc cctatacctt gtctgcctcc ccgcgttgcg tcgcggtgca tggagccggg
     3961 ccacctcgac ctgaatggaa gccggcggca cctcgctaac ggattcacca ctccaagaat
     4021 tggagccaat caattcttgc ggagaactgt gaatgcgcaa accaaccctt ggcagaacat
     4081 atccatcgcg tccgccatct ccagcagccg cacgcggcgc atctcgggca gcgttgggtc
     4141 ctggccacgg gtgcgcatga tcgtgctcct gtcgttgagg acccggctag gctggcgggg
     4201 ttgccttact ggttagcaga atgaatcacc gatacgcgag cgaacgtgaa gcgactgctg
     4261 ctgcaaaacg tctgcgacct gagcaacaac atgaatggtc ttcggtttcc gtgtttcgta
     4321 aagtctggaa acgcggaagt cagcgccctg caccattatg ttccggatct gcatcgcagg
     4381 atgctgctgg ctaccctgtg gaacacctac atctgtatta acgaagcgct ggcattgacc
     4441 ctgagtgatt tttctctggt cccgccgcat ccataccgcc agttgtttac cctcacaacg
     4501 ttccagtaac cgggcatgtt catcatcagt aacccgtatc gtgagcatcc tctctcgttt
     4561 catcggtatc attaccccca tgaacagaaa tcccccttac acggaggcat cagtgaccaa
     4621 acaggaaaaa accgccctta acatggcccg ctttatcaga agccagacat taacgcttct
     4681 ggagaaactc aacgagctgg acgcggatga acaggcagac atctgtgaat cgcttcacga
     4741 ccacgctgat gagctttacc gcagctgcct cgcgcgtttc ggtgatgacg gtgaaaacct
     4801 ctgacacatg cagctcccgg agacggtcac agcttgtctg taagcggatg ccgggagcag
     4861 acaagcccgt cagggcgcgt cagcgggtgt tggcgggtgt cggggcgcag ccatgaccca
     4921 gtcacgtagc gatagcggag tgtatactgg cttaactatg cggcatcaga gcagattgta
     4981 ctgagagtgc accatatgcg gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc
     5041 atcaggcgct cttccgcttc ctcgctcact gactcgctgc gctcggtcgt tcggctgcgg
     5101 cgagcggtat cagctcactc aaaggcggta atacggttat ccacagaatc aggggataac
     5161 gcaggaaaga acatgtgagc aaaaggccag caaaaggcca ggaaccgtaa aaaggccgcg
     5221 ttgctggcgt ttttccatag gctccgcccc cctgacgagc atcacaaaaa tcgacgctca
     5281 agtcagaggt ggcgaaaccc gacaggacta taaagatacc aggcgtttcc ccctggaagc
     5341 tccctcgtgc gctctcctgt tccgaccctg ccgcttaccg gatacctgtc cgcctttctc
     5401 ccttcgggaa gcgtggcgct ttctcatagc tcacgctgta ggtatctcag ttcggtgtag
     5461 gtcgttcgct ccaagctggg ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc
     5521 ttatccggta actatcgtct tgagtccaac ccggtaagac acgacttatc gccactggca
     5581 gcagccactg gtaacaggat tagcagagcg aggtatgtag gcggtgctac agagttcttg
     5641 aagtggtggc ctaactacgg ctacactaga aggacagtat ttggtatctg cgctctgctg
     5701 aagccagtta ccttcggaaa aagagttggt agctcttgat ccggcaaaca aaccaccgct
     5761 ggtagcggtg gtttttttgt ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa
     5821 gaagatcctt tgatcttttc tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa
     5881 gggattttgg tcatgagatt atcaaaaagg atcttcacct agatcctttt aaattaaaaa
     5941 tgaagtttta aatcaatcta aagtatatat gagtaaactt ggtctgacag ttaccaatgc
     6001 ttaatcagtg aggcacctat ctcagcgatc tgtctatttc gttcatccat agttgcctga
     6061 ctccccgtcg tgtagataac tacgatacgg gagggcttac catctggccc cagtgctgca
     6121 atgataccgc gagacccacg ctcaccggct ccagatttat cagcaataaa ccagccagcc
     6181 ggaagggccg agcgcagaag tggtcctgca actttatccg cctccatcca gtctattaat
     6241 tgttgccggg aagctagagt aagtagttcg ccagttaata gtttgcgcaa cgttgttgcc
     6301 attgctgcag gcatcgtggt gtcacgctcg tcgtttggta tggcttcatt cagctccggt
     6361 tcccaacgat caaggcgagt tacatgatcc cccatgttgt gcaaaaaagc ggttagctcc
     6421 ttcggtcctc cgatcgttgt cagaagtaag ttggccgcag tgttatcact catggttatg
     6481 gcagcactgc ataattctct tactgtcatg ccatccgtaa gatgcttttc tgtgactggt
     6541 gagtactcaa ccaagtcatt ctgagaatag tgtatgcggc gaccgagttg ctcttgcccg
     6601 gcgtcaacac gggataatac cgcgccacat agcagaactt taaaagtgct catcattgga
     6661 aaacgttctt cggggcgaaa actctcaagg atcttaccgc tgttgagatc cagttcgatg
     6721 taacccactc gtgcacccaa ctgatcttca gcatctttta ctttcaccag cgtttctggg
     6781 tgagcaaaaa caggaaggca aaatgccgca aaaaagggaa taagggcgac acggaaatgt
     6841 tgaatactca tactcttcct ttttcaatat tattgaagca tttatcaggg ttattgtctc
     6901 atgagcggat acatatttga atgtatttag aaaaataaac aaataggggt tccgcgcaca
     6961 tttccccgaa aagtgccacc tgacgtctaa gaaaccatta ttatcatgac attaacctat
     7021 aaaaa
//